Edit |   |
---|---|
Antigenic Specificity | FAM55D |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-FAM55D polyclonal antibody, unconjugated |
Immunogen | FAM55 D antibody was raised using the C terminal of FAM55 corresponding to a region with amino acids TYSVKEMEYLTRAIDRTGGEKNTVIVISLGQHFRPFPIDVFIRRALNVHK |
Other Names | C11orf33|FAM55D|NXPE family member 4|family with sequence similarity 55|member D|protein FAM55D|neurexophilin and PC-esterase domain family member 4|NXPE4|Family with Sequence Similarity 55, Member D|C130036J11|D930028F11Rik|hypothetical protein LOC244853|neurexophilin and PC-esterase domain family, member 4 |
Gene, Accession # | Gene ID: 54827, 489394, 500991 |
Catalog # | ABIN630400 |
Price | $902 |
Order / More Info | FAM55D Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |