Edit |   |
---|---|
Antigenic Specificity | HNRNPA1L2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-HNRNPA1L2 polyclonal antibody, unconjugated |
Immunogen | RP11-78 J21.1 antibody was raised using the N terminal of RP11-78 21.1 corresponding to a region with amino acids MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN |
Other Names | hnRNP A1-like 2|hnRNP core protein A1-like 2|heterogeneous nuclear ribonucleoprotein A1-like 2|HNRNPA1L2|heterogeneous nuclear ribonucleoprotein A1|LOC785761 |
Gene, Accession # | Gene ID: 144983, 477592 |
Catalog # | ABIN633345 |
Price | $1020 |
Order / More Info | HNRNPA1L2 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |