Edit |   |
---|---|
Antigenic Specificity | IGHV5-2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-IGHV5-2 polyclonal antibody, unconjugated |
Immunogen | PIGZ antibody was raised using the N terminal of PIGZ corresponding to a region with amino acids VLWGGLSLLRVLWCLLPQTGYVHPDEFFQSPEVMAEDILGVQAARPWEFY |
Other Names | Immunoglobulin Heavy Variable 5-2|IGHV5-2 |
Gene, Accession # | n/a |
Catalog # | ABIN635673 |
Price | $1020 |
Order / More Info | IGHV5-2 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |