Edit |   |
---|---|
Antigenic Specificity | C19orf46 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-C19orf46 polyclonal antibody, unconjugated |
Immunogen | C19 ORF46 antibody was raised using the N terminal Of C19 rf46 corresponding to a region with amino acids GEESTSPEQAQTLGQDSLGPPEHFQGGPRGNEPAAHPPRWSTPSSYEDPA |
Other Names | C19orf46|Nesp4|nesprin-4|nuclear envelope spectrin repeat protein 4|spectrin repeat containing nuclear envelope family member 4|SYNE4|Chromosome 19 Open Reading Frame 46|C18H19orf46|0610012K07Rik|AI428936|spectrin repeat containing, nuclear envelope family member 4|RGD1304580|KASH domain-containing protein C19orf46 homolog|C1H19orf46 |
Gene, Accession # | Gene ID: 163183 |
Catalog # | ABIN635247 |
Price | $1020 |
Order / More Info | C19orf46 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |