Edit |   |
---|---|
Antigenic Specificity | PPP4R2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-PPP4R2 polyclonal antibody, unconjugated |
Immunogen | PPP4 R2 antibody was raised using the C terminal of PPP4 2 corresponding to a region with amino acids DSRCTRQHCTEEDEEEDEEEEEESFMTSREMIPERKNQEKESDDALTVNE |
Other Names | PP4R2|serine hreonine-protein phosphatase 4 regulatory subunit 2|protein phosphatase 4 regulatory subunit 2|PPP4R2|Protein Phosphatase 4, Regulatory Subunit 2|BE691708|C230060M08Rik|fe11b04|wu:fe11b04|serine hreonine-protein phosphatase 4 regulatory subunit 2-A|protein phosphatase 4|regulatory subunit 2|protein phosphatase 4, regulatory subunit 2a|ppp4r2a|ppp4r2-B|serine hreonine-protein phosphatase 4 regulatory subunit 2-B|protein phosphatase 4 regulatory subunit 2 S homeolog|ppp4r2.S|wu:fa17h08|wu:fc23g05|protein phosphatase 4, regulatory subunit 2b|ppp4r2b |
Gene, Accession # | Gene ID: 151987, 232314, 297486 |
Catalog # | ABIN632513 |
Price | $1020 |
Order / More Info | PPP4R2 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |