Edit |   |
---|---|
Antigenic Specificity | Glucagon |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-Glucagon polyclonal antibody, unconjugated |
Immunogen | Glucagon antibody was raised using the N terminal of GCG corresponding to a region with amino acids LSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAK |
Other Names | GLP1|GLP2|GRPP|glicentin-related polypeptide|glucagon-like peptide 1|glucagon-like peptide 2|preproglucagon|glucagon|GCG|GLP-1|Glu|PPG|glucagon-like peptide I|glucagon-like peptide-1|proglucagon|preproglucagon B|glucagon preproprotein|preproglucagon A|gcg-A|gcg1|glucagon I|glucagon-1|proglucagon I|glucagon L homeolog|gcg.L |
Gene, Accession # | Gene ID: 2641, 14526, 24952, 403571 |
Catalog # | ABIN630283 |
Price | $902 |
Order / More Info | Glucagon Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |