Edit |   |
---|---|
Antigenic Specificity | HAS3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-HAS3 polyclonal antibody, unconjugated |
Immunogen | HAS3 antibody was raised using the C terminal of HAS3 corresponding to a region with amino acids SDTVLDPACTIEMLRVLEEDPQVGGVGGDVQPPGKGMAVEDDQVQAAQVR |
Other Names | HA synthase 3|hyaluronate synthase 3|hyaluronic acid synthase 3|hyaluronan synthase 3|HAS3|dg42III|xx:af190743gs1|xx:af190743gs2|af190743gs2|CHAS3|hyaluronan synthase 3-like|xhas3|hyaluronan synthase 3 S homeolog|has3.S |
Gene, Accession # | Gene ID: 3038, 15118, 266805 |
Catalog # | ABIN635963 |
Price | $1020 |
Order / More Info | HAS3 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |