Edit |   |
---|---|
Antigenic Specificity | RGS20 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-RGS20 polyclonal antibody, unconjugated |
Immunogen | RGS20 antibody was raised using the N terminal of RGS20 corresponding to a region with amino acids KHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVPDIKSFPPAQLP |
Other Names | RGSZ1|ZGAP1|g(z)GAP|gz-GAP|gz-selective GTPase-activating protein|regulator of G-protein signaling 20 variant 2|regulator of G-protein signaling Z1|regulator of G-protein signalling 20|regulator of Gz-selective protein signaling 1|regulator of G protein signaling 20|RGS20|Regulator of G-Protein Signaling 20|RSG20|RET-RGS1|retina-specific regulator of G-protein signaling 1|2900073E09Rik|zgc:92650|regulator of G-protein signaling 20 L homeolog|rgs20.L|GzGAP|Gz-specific GAP|RGS protein Gz-GAP |
Gene, Accession # | Gene ID: 8601 |
Catalog # | ABIN629702 |
Price | $902 |
Order / More Info | RGS20 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |