Edit |   |
---|---|
Antigenic Specificity | BRI3BP |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-BRI3BP polyclonal antibody, unconjugated |
Immunogen | BRI3 BP antibody was raised using the C terminal of BRI3 P corresponding to a region with amino acids GFYWRSSPSGPSNPSNPSVEEKLEHLEKQVRLLNIRLNRVLESLDRSKDK |
Other Names | BNAS1|HCCR-1|HCCR-2|HCCRBP-1|KG19|BRI3-binding protein|I3-binding protein|cervical cancer 1 proto-oncogene-binding protein KG19|cervical cancer oncogene binding protein|BRI3 binding protein|BRI3BP|2410150I18Rik|AI841257|AW742481|fa20c12|wu:fa20c12|BASHBLNK N-terminal associated protein 1|BRI3 binding protein pseudogene|LOC452360|BRI3 binding protein L homeolog|bri3bp.L |
Gene, Accession # | Gene ID: 140707 |
Catalog # | ABIN635825 |
Price | $1020 |
Order / More Info | BRI3BP Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |