Edit |   |
---|---|
Antigenic Specificity | CYP2C18 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-CYP2C18 polyclonal antibody, unconjugated |
Immunogen | CYP2 C18 antibody was raised using the N terminal of CYP2 18 corresponding to a region with amino acids MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDM |
Other Names | CPCJ|CYP2C|P450C2C|P450IIC19|(R)-limonene 6-monooxygenase|(S)-limonene 6-monooxygenase|(S)-limonene 7-monooxygenase|CYPIIC17|CYPIIC19|S-mephenytoin 4-hydroxylase|cytochrome P-450 II C|cytochrome P450 2C19|cytochrome P450|subfamily IIC (mephenytoin 4-hydroxylase)|polypeptide 19|cytochrome P450-11A|cytochrome P450-254C|flavoprotein-linked monooxygenase|mephenytoin 4'-hydroxylase|mephenytoin 4-hydroxylase|microsomal monooxygenase|xenobiotic monooxygenase|cytochrome P450 family 2 subfamily C member 19|CYP2C19|Cytochrome P450, Family 2, Subfamily C, Polypeptide 18|CYP2C18|CPCI|CYP2C17|P450-6B29C|P450IIC17|(S)-mephenytoin hydroxylase associated cytochrome P450|CYPIIC18|cytochrome P450 2C18|polypeptide 17|polypeptide 18|cytochrome P450-6B29C|unspecific monooxygenase|cytochrome P450 family 2 subfamily C member 18|cytochrome P450 family 2 subfamily C member 18 L homeolog|cyp2c18.L|MGC139147|family 2|subfamily C |
Gene, Accession # | Gene ID: 1562 |
Catalog # | ABIN633982 |
Price | $1020 |
Order / More Info | CYP2C18 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |