Edit |   |
---|---|
Antigenic Specificity | UPF3B |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-UPF3B polyclonal antibody, unconjugated |
Immunogen | UPF3 B antibody was raised using a synthetic peptide corresponding to a region with amino acids MKEEKEHRPKEKRVTLLTPAGATGSGGGTSGDSSKGEDKQDRNKEKKEAL |
Other Names | HUPF3B|MRXS14|RENT3B|UPF3X|hUpf3p-X|nonsense mRNA reducing factor 3B|regulator of nonsense transcripts 3B|up-frameshift suppressor 3 homolog B|up-frameshift suppressor 3 homolog on chromosome X|UPF3B, regulator of nonsense mediated mRNA decay|UPF3B|UPF3 Regulator of Nonsense Transcripts Homolog B|5730594O13Rik|AI317193|AW541158|UPF3 regulator of nonsense transcripts homolog B (yeast)|RGD1560264|zgc:174674|zgc:66390 |
Gene, Accession # | Gene ID: 65109, 481031 |
Catalog # | ABIN629921 |
Price | $902 |
Order / More Info | UPF3B Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |