Edit |   |
---|---|
Antigenic Specificity | LRFN3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-LRFN3 polyclonal antibody, unconjugated |
Immunogen | LRFN3 antibody was raised using the C terminal of LRFN3 corresponding to a region with amino acids VYRMIPAESRSFLLTDLASGRTYDLCVLAVYEDSATGLTATRPVGCARFS |
Other Names | FIGLER1|SALM4|fibronectin type III|immunoglobulin and leucine rich repeat domains 1|leucine-rich repeat and fibronectin type-III domain-containing protein 3|synaptic adhesion-like molecule 4|leucine rich repeat and fibronectin type III domain containing 3|LRFN3|A530045B06Rik|leucine-rich repeat and fibronectin type-III domain-containing protein 3-like|LOW QUALITY PROTEIN: leucine-rich repeat and fibronectin type-III domain-containing protein 3 |
Gene, Accession # | Gene ID: 79414, 233067, 308495 |
Catalog # | ABIN635732 |
Price | $1020 |
Order / More Info | LRFN3 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |