Edit |   |
---|---|
Antigenic Specificity | MYH10 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-MYH10 polyclonal antibody, unconjugated |
Immunogen | MYH10 antibody was raised using the N terminal of MYH10 corresponding to a region with amino acids WFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKAD |
Other Names | 5730504C04Rik|9330167F11Rik|Fltn|Myhn-2|Myhn2|NMHC II-B|NMHC-B|NMHCII-B|NMMHC II-b|NMMHC-B|NMMHC-IIB|SMemb|mKIAA3005|cellular myosin heavy chain|type B|flectin|myosin IIB|myosin heavy chain 10|non-muscle|myosin heavy chain|non-muscle IIb|nonmuscular|myosin-10|non-muscle myosin heavy chain B|non-muscle myosin heavy chain IIb|nonmuscle myosin heavy chain II-B|myosin, heavy polypeptide 10, non-muscle|Myh10|MCH-B|MCH-B(B2)|nonmuscle type B|myosin|heavy polypeptide 10|nonmuscle myosin heavy chain IIB|nonmuscle myosin heavy chain-B|nmmhcb|nonmuscle myosin heavy chain b|myosin, heavy chain 10, non-muscle S homeolog|myh10.S|nonmuscle myosin II heavy chain-B|nonmuscle myosin heavy chain|myosin, heavy chain 10, non-muscle|dZ204D19.2|si:dz150i12.3|wu:fc46h07|wu:fy19d11|nm-mhc-b |
Gene, Accession # | Gene ID: 4628, 77579, 79433 |
Catalog # | ABIN631458 |
Price | $1020 |
Order / More Info | MYH10 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |