Edit |   |
---|---|
Antigenic Specificity | TMEM69 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-TMEM69 polyclonal antibody, unconjugated |
Immunogen | TMEM69 antibody was raised using the middle region of TMEM69 corresponding to a region with amino acids AYGASFLSFLGGIRWGFALPEGSPAKPDYLNLASSAAPLFFSWFAFLISE |
Other Names | C1orf154|RP11-767N6.4|transmembrane protein 69|TMEM69|tmm69|A630048M13Rik|zgc:194288|zgc:194295 |
Gene, Accession # | Gene ID: 51249 |
Catalog # | ABIN635451 |
Price | $1020 |
Order / More Info | TMEM69 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |