Edit |   |
---|---|
Antigenic Specificity | TRIM59 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-TRIM59 polyclonal antibody, unconjugated |
Immunogen | TRIM59 antibody was raised using the middle region of TRIM59 corresponding to a region with amino acids LEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNV |
Other Names | MRF1|RNF104|TRIM57|TSBF1|RING finger protein 104|tripartite motif-containing 57|tripartite motif-containing 59|tripartite motif-containing protein 59|tumor suppressor TSBF-1|tumor suppressor TSBF1|tripartite motif containing 59|TRIM59|2310035M22Rik|2700022F13Rik|RING finger 1|RING finger protein 1|tumor suppressor TSBF1 homolog|RGD1311956|zgc:193694|zgc:193700|LYR motif-containing protein 9|UPF0631 protein C17orf108 homolog|LYR motif containing 9|lyrm9|tripartite motif-containing protein 59-like |
Gene, Accession # | Gene ID: 66949, 286827, 365813, 488133 |
Catalog # | ABIN630352 |
Price | $902 |
Order / More Info | TRIM59 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |