Edit |   |
---|---|
Antigenic Specificity | B4GALNT3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-B4GALNT3 polyclonal antibody, unconjugated |
Immunogen | B4 GALNT3 antibody was raised using the N terminal of B4 ALNT3 corresponding to a region with amino acids NEEGTDHVEVAWRRNDPGAKFTIIDSLSLSLFTNETFLQMDEVGHIPQTA |
Other Names | B4GalNAcT3|Beta4GalNAc-T3|N-acetyl-beta-glucosaminyl-glycoprotein 4-beta-N- acetylgalactosaminyltransferase|N-acetyl-beta-glucosaminyl-glycoprotein 4-beta-N-acetylgalactosaminyltransferase 2|NGalNAc-T2|beta-1|4-N-acetylgalactosaminyltransferase 3|4-N-acetylgalactosaminyltransferase III|beta4GalNAcT3|beta-1,4-N-acetyl-galactosaminyltransferase 3|B4GALNT3|beta-1,4-N-Acetyl-Galactosaminyl Transferase 3|AB114826|C330047A21|beta 1|4-N-acetylgalactosaminyltransferase-transferase 3|4-N-acetylgalactosaminyltransferase-transferase-III|4-N-acetyl-galactosaminyl transferase 3|RGD1561056|hypothetical protein LOC527026|n-acetyl-beta-glucosaminyl-glycoprotein 4-beta-N-acetylgalactosaminyltransferase 2-like |
Gene, Accession # | Gene ID: 283358, 330406 |
Catalog # | ABIN636034 |
Price | $1020 |
Order / More Info | B4GALNT3 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |