Edit |   |
---|---|
Antigenic Specificity | RAP1B |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | Drosophila melanogaster, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-RAP1B polyclonal antibody, unconjugated |
Immunogen | RAP1 B antibody was raised using the N terminal of RAP1 corresponding to a region with amino acids MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQ |
Other Names | K-REV|RAL1B|GTP-binding protein smg p21B|RAS-related protein RAP1B|Ras family small GTP binding protein RAP1B|ras-related protein Rap-1b|small GTP binding protein|RAP1B, member of RAS oncogene family|RAP1B|RAS related protein 1b|RAP1B, member of RAS oncogene family L homeolog|rap1b.L|member of RAS oncogene family|Bm1_39445|2810443E11Rik|ras-related protein Rap-1b-like|LOC109067672|cb1026|cb119|sb:cb119|wu:fb11c04|wu:fb74e09|wu:fk70e05|Ras-related protein Rap-1b-like protein|ras-related protein rab-1B-like protein |
Gene, Accession # | Gene ID: 5908, 171337, 215449 |
Catalog # | ABIN631250 |
Price | $1020 |
Order / More Info | RAP1B Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |