Edit |   |
---|---|
Antigenic Specificity | HAVCR1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | hepatitis a virus (hav) |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-HAVCR1 polyclonal antibody, unconjugated |
Immunogen | HAVCR1 antibody was raised using the N terminal of HAVCR1 corresponding to a region with amino acids CHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSR |
Other Names | HAVCR|HAVCR-1|KIM-1|KIM1|TIM|TIM-1|TIM1|TIMD-1|TIMD1|T cell immunoglobin domain and mucin domain protein 1|T-cell membrane protein 1|kidney injury molecule 1|hepatitis A virus cellular receptor 1|HAVCR1|hepatitis A virus cellular receptor 1 homolog|t cell immunoglobulin and mucin domain-containing protein 1|LOC100226241|AI503787|T-cell immunoglobulin and mucin domain containing 1|t cell membrane protein 1|T-cell immunoglobulin and mucin domain-containing protein 1 |
Gene, Accession # | Gene ID: 26762, 171283 |
Catalog # | ABIN635773 |
Price | $1020 |
Order / More Info | HAVCR1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |