Edit |   |
---|---|
Antigenic Specificity | EIF5 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-EIF5 polyclonal antibody, unconjugated |
Immunogen | EIF5 antibody was raised using the N terminal of EIF5 corresponding to a region with amino acids SVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPT |
Other Names | EIF-5|EIF-5A|eukaryotic translation initiation factor 5|EIF5|eukaryotic initiation factor 5 (eIF-5)|2810011H21Rik|D12Ertd549e|fb37c12|fb54h04|zgc:56606|zgc:77026|wu:fb37c12|wu:fb54h04|DKEYP-72H1.3|CG9177|DmelCG9177|anon-EST:fe3C6|CG9177-PA|CG9177-PB|CG9177-PC|CG9177-PD|CG9177-PE|CG9177-PF|CG9177-PG|anon-fast-evolving-3C6|eIF5-PA|eIF5-PB|eIF5-PC|eIF5-PD|eIF5-PE|eIF5-PF|eIF5-PG|CG9177 gene product from transcript CG9177-RD|eukaryotic translation initiation factor 5 S homeolog|eif5.S|Eukaryotic initiation factor-5 |
Gene, Accession # | Gene ID: 1983, 217869, 108348073 |
Catalog # | ABIN631763 |
Price | $1020 |
Order / More Info | EIF5 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |