Edit |   |
---|---|
Antigenic Specificity | HEY1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-HEY1 polyclonal antibody, unconjugated |
Immunogen | HEY1 antibody was raised using the N terminal of HEY1 corresponding to a region with amino acids ALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQG |
Other Names | BHLHb31|CHF2|HERP2|HESR1|HRT-1|OAF1|HES-related repressor protein 1|HES-related repressor protein 2|basic helix-loop-helix protein OAF1|cardiovascular helix-loop-helix factor 2|class B basic helix-loop-helix protein 31|hHRT1|hairy and enhancer of split-related protein 1|hairy-related transcription factor 1|hairyenhancer-of-split related with YRPW motif protein 1|hes related family bHLH transcription factor with YRPW motif 1|HEY1|Ha-Ry/enhancer-of-Split Related with YRPW Motif 1|AI316788|AI414254|HRT1|hesr-1|HairyE(spl)-related with YRPW motif 1|mHRT1|hairy/enhancer-of-split related with YRPW motif 1|id:ibd1292|zgc:110572|IBD1292|basic helix-loop-helix transcription factor|hes-related family bHLH transcription factor with YRPW motif 1|bc8|xbc8|XHRT1|XHey-1|bHLH protein Hesr-1Hey1|protein xbc8|xHRT-1|hes related family bHLH transcription factor with YRPW motif 1 S homeolog|hey1.S|cardiovascular basic helix-loop-helix factor 2|hairyenhancer-of-split related with YRPW motif 1 |
Gene, Accession # | Gene ID: 15213, 23462, 155437, 403420 |
Catalog # | ABIN633815 |
Price | $1020 |
Order / More Info | HEY1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |