Edit |   |
---|---|
Antigenic Specificity | VASH1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-VASH1 polyclonal antibody, unconjugated |
Immunogen | Vasohibin 1 antibody was raised using the N terminal of VASH1 corresponding to a region with amino acids ATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPER |
Other Names | KIAA1036|vasohibin-1|vasohibin 1|VASH1|AI834978|D930046M13Rik|G630009D10Rik|RGD1564082|vasohibin-1-like |
Gene, Accession # | Gene ID: 22846, 238328, 503052 |
Catalog # | ABIN630629 |
Price | $1020 |
Order / More Info | VASH1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |