Edit |   |
---|---|
Antigenic Specificity | DDX5 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-DDX5 polyclonal antibody, unconjugated |
Immunogen | DDX5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAY |
Other Names | G17P1|HLR1|HUMP68|p68|ATP-dependent RNA helicase DDX5|DEAD (Asp-Glu-Ala-Asp) box polypeptide 5|DEAD box protein 5|DEAD box-5|DEADH (Asp-Glu-Ala-AspHis) box polypeptide 5 (RNA helicase|68kD)|RNA helicase p68|probable ATP-dependent RNA helicase DDX5|DEAD-box helicase 5|DDX5|2600009A06Rik|D-E-A-D (aspartate-glutamate-alanine-aspartate) box polypeptide 5|DEAD (aspartate-glutamate-alanine-aspartate) box polypeptide 5|DEAD box RNA helicase DEAD1|DEADH (Asp-Glu-Ala-AspHis) box polypeptide 5|mDEAD1|p68 RNA helicase|ddx5 gene protein|wu:fa56a07|wu:fb11e01|wu:fb16c10|wu:fb53b05|DEAD (Asp-Glu-Ala-Asp) box helicase 5|PCR product with interspecies-compatible primers|putative ATP-dependent RNA helicase DDX5|DEAD-box helicase 5 L homeolog|ddx5.L |
Gene, Accession # | Gene ID: 1655, 13207, 287765, 480472 |
Catalog # | ABIN629955 |
Price | $902 |
Order / More Info | DDX5 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |