Edit |   |
---|---|
Antigenic Specificity | PRMT8 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-PRMT8 polyclonal antibody, unconjugated |
Immunogen | PRMT8 antibody was raised using the C terminal of PRMT8 corresponding to a region with amino acids YLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSND |
Other Names | HRMT1L3|HRMT1L4|HMT1 hnRNP methyltransferase-like 3|heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4|protein arginine N-methyltransferase 4|protein arginine N-methyltransferase 8|protein arginine methyltransferase 8|PRMT8|HMT1 hnRNP methyltransferase-like 4|fj34f03|wu:fj34f03|zfL3|protein arginine N-methyltransferase 8-B|protein arginine methyltransferase 8b|prmt8b|heterogeneous nuclear ribonucleoprotein methyltransferase-like 4 |
Gene, Accession # | Gene ID: 56341, 381813, 486740, 688502 |
Catalog # | ABIN629836 |
Price | $902 |
Order / More Info | PRMT8 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |