Edit |   |
---|---|
Antigenic Specificity | C19orf24 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-C19orf24 polyclonal antibody, unconjugated |
Immunogen | C19 ORF24 antibody was raised using the N terminal Of C19 rf24 corresponding to a region with amino acids MREGQEMGPTPVPSNPLLHRSFPCWPRGWSHPVPTRELLLEPAQPADLLP |
Other Names | uncharacterized membrane protein C19orf24|chromosome 19 open reading frame 24|C19orf24|hypothetical protein LOC733527 |
Gene, Accession # | Gene ID: 55009 |
Catalog # | ABIN633528 |
Price | $1020 |
Order / More Info | C19orf24 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |