Edit |   |
---|---|
Antigenic Specificity | EXD |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | Drosophila melanogaster |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-EXD polyclonal antibody, unconjugated |
Immunogen | EXD antibody was raised using the C terminal Of Exd corresponding to a region with amino acids EAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGA |
Other Names | CG8933|DExd|Dm-EXD|DmelCG8933|Dpbx|EXD|Pbx1|anon-EST:fe1H3|l(1)IV|lincRNA.S9404|td48|CG8933 gene product from transcript CG8933-RA|CG8933-PA|CG8933-PB|CG8933-PD|CG8933-PE|Pbx1-oncogene-like|anon-fast-evolving-1H3|exd-PA|exd-PB|exd-PD|exd-PE|extradenticle |
Gene, Accession # | Gene ID: 32567 |
Catalog # | ABIN629819 |
Price | $902 |
Order / More Info | EXD Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |