Edit |   |
---|---|
Antigenic Specificity | SLC38A3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SLC38A3 polyclonal antibody, unconjugated |
Immunogen | SLC38 A3 antibody was raised using the N terminal of SLC38 3 corresponding to a region with amino acids GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM |
Other Names | G17|NAT1|SN1|N-system amino acid transporter 1|Na(+)-coupled neutral amino acid transporter 3|sodium-coupled neutral amino acid transporter 3|system N amino acid transporter 1|system N1 Na+ and H+-coupled glutamine transporter|solute carrier family 38 member 3|SLC38A3|Snat3|system N1 amino acid transporter|solute carrier family 38, member 3|wu:fc31c02|wu:fc48a10|zgc:92015|solute carrier family 38|member 3|solute carrier family 38, member 5b|slc38a5b|MGC69392|sodium-coupled neutral amino acid transporter 3-like|0610012J02Rik|D9Ucla2|Slc38-3|mNAT|N system amino acids transporter NAT-1 |
Gene, Accession # | Gene ID: 10991, 76257 |
Catalog # | ABIN635610 |
Price | $1020 |
Order / More Info | SLC38A3 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |