Edit |   |
---|---|
Antigenic Specificity | LYPLA2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-LYPLA2 polyclonal antibody, unconjugated |
Immunogen | LYPLA2 antibody was raised using the N terminal of LYPLA2 corresponding to a region with amino acids MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLP |
Other Names | APT-2|DJ886K2.4|LPL-II|acyl-protein thioesterase 2|lysoPLA II|lysophospholipase II|LYPLA2|LysoII|mLyso II|lysophospholipase 2|MGC52664|lysophospholipase II S homeolog|lypla2.S|MGC75683|LYPLA2P1 |
Gene, Accession # | Gene ID: 26394, 83510 |
Catalog # | ABIN632189 |
Price | $1020 |
Order / More Info | LYPLA2 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |