Edit |   |
---|---|
Antigenic Specificity | Adipsin |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | Drosophila melanogaster |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-Adipsin polyclonal antibody, unconjugated |
Immunogen | EVE antibody was raised using the N terminal Of Eve corresponding to a region with amino acids MHGYRTYNMESHHAHHDASPVDQKPLVVDLLATQYGKPQTPPPSPNECLS |
Other Names | ADIPSIN|ADN|DF|PFD|C3 convertase activator|D component of complement (adipsin)|complement factor D|complement factor D preproprotein|properdin factor D|CFD|28 kDa adipocyte protein|D component (adipsin) of complement|complement factor D (adipsin)|EVE|endogenous vascular elastase|Ami|serine protease ami|complement factor D (adipsin) L homeolog|cfd.L|cfdl|wu:fb61f12|zgc:109940|complement factor D (adipsin) like|fb61f12|10.5|10.9|14.10|20.35|CG2328|DmelCG2328|E(eve)|F|V|VI|eve2|even|l(2)46CFg|l(2)46CFh|l(2)46CFj|l(2)46CFp|l(2)46Ce|l(2)46Cg|CG2328-PA|EVEN-SKIPPED|complementation group F|eve-PA|even-skiped|evenskip|evenskipped|group V|group VI|lethal(2)46Ce|even skipped|LOW QUALITY PROTEIN: complement factor D |
Gene, Accession # | Gene ID: 36039 |
Catalog # | ABIN631122 |
Price | $1020 |
Order / More Info | Adipsin Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |