Edit |   |
---|---|
Antigenic Specificity | Desmin |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-Desmin polyclonal antibody, unconjugated |
Immunogen | Desmin antibody was raised using the N terminal of DES corresponding to a region with amino acids PLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTR |
Other Names | CSM1|CSM2|LGMD2R|intermediate filament protein|desmin|DES|MGC52614|des-a|desmin, gene 1 S homeolog|des.1.S|MGC80853|des-b|desmin, gene 1 L homeolog|des.1.L|MGC75911|cmd1i|desm|gene 1|desmin, gene 1|des.1|desmin, gene 2 S homeolog|des.2.S|LOC100220724|desmin-like|cb290|fb59a12|wu:fb59a12|zgc:109859|desmin a|desma|wu:fc11d08|zgc:154009|fc11d08|desmin b|desmb|muscle-specific intermediate filament desmin |
Gene, Accession # | Gene ID: 1674, 13346, 64362 |
Catalog # | ABIN629811 |
Price | $902 |
Order / More Info | Desmin Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |