GABRG2 Antibody from ANTIBODIES-ONLINE GmbH

Search, find, compare suppliers for anti-GABRG2 antibody, protein, ELISA kits.

Edit 
Antigenic SpecificityGABRG2
Clonepolyclonal
Host SpeciesRabbit
Reactive Speciesdog, human, mouse, rat
Isotypen/a
Formatunconjugated
Size100 µg
ConcentrationLot specific
ApplicationsWestern Blotting
Reviews / RatingsIf you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
DescriptionProduct Characteristics: Gamma-aminobutyric acid (GABA), the major inhibitory neurotransmitter in the brain, mediates neuronal inhibition by binding to GABA receptors. The type A GABA receptors are pentameric chloride channels assembled from among many genetic variants of GABA(A) subunits. GABRG2 is the gamma 2 subunit of GABA(A) receptor. Mutations in this gene have been associated with epilepsy and febrile seizures.Target Information: This gene encodes a gamma-aminobutyric acid (GABA) receptor. GABA is the major inhibitory neurotransmitter in the mammlian brain, where it acts at GABA-A receptors, which are ligand-gated chloride channels. GABA-A receptors are pentameric, consisting of proteins from several subunit classes: alpha, beta, gamma, delta and rho. Mutations in this gene have been associated with epilepsy and febrile seizures. Multiple transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008].
ImmunogenGABRG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMDLFVSVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPAPTIDIR
Other NamesGABAA-R|Gabrg-2|gamma2|gamma-aminobutyric acid receptor subunit gamma-2|gamma-aminobutyric acid (GABA) A receptor, subunit gamma 2|Gabrg2|gamma-aminobutyric Acid (GABA) A Receptor, gamma 2|gamma-aminobutyric acid type A receptor gamma2 subunit|gamma-aminobutyric acid A receptor gamma 2|GABA(A) receptor subunit gamma-2|CAE2|ECA2|GEFSP3|GABA(A) receptor|gamma 2|GABA-A receptor gamma-2 subunit|gabrg1|gamma-aminobutyric acid A receptor|gamma 1|gamma-aminobutyric acid (GABA) A receptor|gamma-aminobutyric acid receptor subunit gamma-2-like|gamma-aminobutyric acid A receptor|gamma-aminobutyric acid (GABA-A) receptor|subunit gamma 2|gamma-aminobutyric acid type A receptor gamma 2 subunit|si:ch211-145n14.1
Gene, Accession #Gene ID: 2566, 14406, 29709, 489141
Catalog #ABIN630118
Price$388.93
Order / More InfoGABRG2 Antibody from ANTIBODIES-ONLINE GmbH
Product Specific Referencesn/a
ANTIBODIES-ONLINE GmbH
ANTIBODIES-ONLINE GmbH
ANTIBODIES-ONLINE GmbH
Schloss-Rahe-Str. 15
52072 Aachen GERMANY
P: +49 (0)241 95 163 153
F: +49 (0)241 95 163 155

info@antibodies-online.com
Orders: orders@antibodies-online.com
Technical Support: support@antibodies-online.com

https://www.antibodies-online.com

Profile of ANTIBODIES-ONLINE GmbH
Return to Antibodies

© 1980 - 2021 Linscott's Directory, Linscott's USA. All rights reserved.