Edit |   |
---|---|
Antigenic Specificity | C19orf18 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-C19orf18 polyclonal antibody, unconjugated |
Immunogen | C19 orf18 antibody was raised using the N terminal of C19 rf18 corresponding to a region with amino acids NITGLPGSKRSQPPRNITKEPKVFFHKTQLPGIQGAASRSTAASPTNPMK |
Other Names | uncharacterized protein C19orf18|chromosome 19 open reading frame 18|C19orf18 |
Gene, Accession # | Gene ID: 147685 |
Catalog # | ABIN633114 |
Price | $1020 |
Order / More Info | C19orf18 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |