Edit |   |
---|---|
Antigenic Specificity | RDH11 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-RDH11 polyclonal antibody, unconjugated |
Immunogen | RDH11 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIAR |
Other Names | ARSDR1|CGI82|HCBP12|MDT1|PSDR1|RALR1|SCALD|SDR7C1|HCV core-binding protein HCBP12|androgen-regulated short-chain dehydrogenase eductase 1|prostate short-chain dehydrogenase reductase 1|prostate short-chain dehydrogenase eductase 1|retinal reductase 1|retinol dehydrogenase 11|short chain dehydrogenase eductase family 7C|member 1|retinol dehydrogenase 11 (all-trans/9-cis/11-cis)|RDH11|retinol dehydrogenase 11 (all-trans9-cis11-cis)|retinol dehydrogenase 11 (all-trans/9-cis/11-cis) S homeolog|rdh11.S|2610319N22Rik|AI428145|AU045252|C85936|CGI-82|M42C60|UBE-1c1|Ube-1c|all-trans and 9-cis|cell line MC9.IL4 derived transcript 1|cell line MC9.IL4-derived protein 1|short-chain aldehyde dehydrogenase|short-chain dehydrogenase eductase 1|ubiquitously expressing |
Gene, Accession # | Gene ID: 51109, 362757 |
Catalog # | ABIN633983 |
Price | $1020 |
Order / More Info | RDH11 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |