Edit |   |
---|---|
Antigenic Specificity | PRR16 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-PRR16 polyclonal antibody, unconjugated |
Immunogen | PRR16 antibody was raised using the middle region of PRR16 corresponding to a region with amino acids RERVRFNEKVQYHGYCPDCDTRYNIKNREVHLHSEPVHPPGKIPHQGPPL |
Other Names | DSC54|mesenchymal stem cell protein DSC54|proline-rich protein 16|proline rich 16|PRR16|5430406M13Rik|AI607429|RGD1564528|protein Largen |
Gene, Accession # | Gene ID: 51334, 71373, 361327 |
Catalog # | ABIN631986 |
Price | $1020 |
Order / More Info | PRR16 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |