Edit |   |
---|---|
Antigenic Specificity | IL18R1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-IL18R1 polyclonal antibody, unconjugated |
Immunogen | IL18 R1 antibody was raised using the N terminal of IL18 1 corresponding to a region with amino acids PFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIALHDCVLE |
Other Names | CD218a|CDw218a|IL-1Rrp|IL18RA|IL1RRP|CD218 antigen-like family member A|IL-18R-1|IL-18R1|IL1 receptor-related protein|IL1R-rp|cytokine receptor|interleukin-18 receptor 1|interleukin 18 receptor 1|IL18R1|IL-1R9|IL1R9|IL1RAPL-2|TIGIRR-1|IL-1 receptor accessory protein-like 2|IL-1R-9|IL1RAPL-2-related protein|X-linked interleukin-1 receptor accessory protein-like 2|interleukin 1 receptor 9|three immunoglobulin domain-containing IL-1 receptor-related 1|interleukin 1 receptor accessory protein like 2|IL1RAPL2|Il18ralpha|interleukin 1 receptor related protein|IL-18Ra|IL-18 receptor alpha|interleukin-18 receptor 1-like |
Gene, Accession # | Gene ID: 8809 |
Catalog # | ABIN635200 |
Price | $1020 |
Order / More Info | IL18R1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |