Edit |   |
---|---|
Antigenic Specificity | TMEM91 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-TMEM91 polyclonal antibody, unconjugated |
Immunogen | TMEM91 antibody was raised using the N terminal of TMEM91 corresponding to a region with amino acids SPPLPSVSAGLGEPRPPDVEDMSSSDSDSDWDGGSRLSPFLPHDHLGLAV |
Other Names | DSPC3|IFITMD6|dispanin subfamily C member 3|interferon induced transmembrane protein domain containing 6|transmembrane protein 91|TMEM91|A830041P22Rik|synapse differentiation-induced protein 3 |
Gene, Accession # | Gene ID: 641649 |
Catalog # | ABIN630330 |
Price | $902 |
Order / More Info | TMEM91 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |