Edit |   |
---|---|
Antigenic Specificity | SYNCRIP |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SYNCRIP polyclonal antibody, unconjugated |
Immunogen | SYNCRIP antibody was raised using the N terminal of SYNCRIP corresponding to a region with amino acids MATEHVNGNGTEEPMDTTSAVIHSENFQTLLDAGLPQKVAEKLDEIYVAG |
Other Names | GRY-RBP|GRYRBP|HNRNPQ|HNRPQ1|NSAP1|PP68|hnRNP-Q|NS1-associated protein 1|glycine- and tyrosine-rich RNA-binding protein|heterogeneous nuclear ribonucleoprotein Q|synaptotagmin binding cytoplasmic RNA interacting protein|SYNCRIP|Synaptotagmin Binding, Cytoplasmic RNA Interacting Protein|2610109K23Rik|4632417O19Rik|Nsap1l|RRM RNA binding protein GRY-RBP|hnRNP Q|synaptotagmin-binding|cytoplasmic RNA-interacting protein|wu:fe02c03|wu:fe47h09|liver regeneration-related protein LRRG077|synaptotagmin binding cytoplasmic RNA interacting protein S homeolog|syncrip.S|synaptotagmin binding|cytoplasmic RNA interacting protein|rp1-3j17.2|heterogeneous nuclear ribonucleoprotein Q-like |
Gene, Accession # | Gene ID: 10492, 56403, 363113, 474986 |
Catalog # | ABIN629882 |
Price | $902 |
Order / More Info | SYNCRIP Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |