Edit |   |
---|---|
Antigenic Specificity | IRF6 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat, zebrafish |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-IRF6 polyclonal antibody, unconjugated |
Immunogen | IRF6 antibody was raised using the C terminal of IRF6 corresponding to a region with amino acids FLSDLIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVAR |
Other Names | LPS|OFC6|PIT|PPS|PPS1|VWS|VWS1|interferon regulatory factor 6|IRF6|AI876454|E230028I05Rik|mirf6|IRF-6|zgc:63500|xIRF-6|interferon regulatory factor 6 S homeolog|irf6.S|DKFZp469E012|interferon regulatory factor 6-like |
Gene, Accession # | Gene ID: 3664, 54139, 364081, 393570, 480015 |
Catalog # | ABIN630193 |
Price | $902 |
Order / More Info | IRF6 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |