Edit |   |
---|---|
Antigenic Specificity | GALC |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-GALC polyclonal antibody, unconjugated |
Immunogen | GALC antibody was raised using the middle region of GALC corresponding to a region with amino acids LMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVAL |
Other Names | GALCERase|galactocerebrosidase|galactocerebroside beta-galactosidase|galactosylceramide beta-galactosidase|galactosylceraminidase|galactosylceramidase|GALC|2310068B06Rik|A930008M05Rik|AW212969|AW413532|Gacy|twi|twitcher|galactosylceramidase (Krabbe disease)|galcl|zgc:92561|si:ch211-199l3.4|galactosylceramidase like|galactosylceramidase a|galca|Caci_7107|Bacsa_1415|Spico_0384|LOC100304802|galactosylceramidase L homeolog|galc.L |
Gene, Accession # | Gene ID: 2581, 14420, 314360 |
Catalog # | ABIN635737 |
Price | $1020 |
Order / More Info | GALC Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |