Edit |   |
---|---|
Antigenic Specificity | IGSF1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-IGSF1 polyclonal antibody, unconjugated |
Immunogen | IGSF1 antibody was raised using the N terminal of IGSF1 corresponding to a region with amino acids LCHGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIFSIDNLTPEDEGVYICR |
Other Names | CHTE|IGCD1|IGDC1|INHBP|PGSF2|p120|immunoglobulin superfamily member 1|immunoglobulin-like domain-containing protein 1|inhibin-binding protein|pituitary gland-specific factor 2|IGSF1|Inhibin Binding Protein|5330413N23|5530402E03|AI747649|InhBPp120|mKIAA0364|betaglycan and inhibin binding protein|immunoglobulin superfamily, member 1|LOC443288|LOW QUALITY PROTEIN: immunoglobulin superfamily member 1 |
Gene, Accession # | Gene ID: 3547 |
Catalog # | ABIN630244 |
Price | $902 |
Order / More Info | IGSF1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |