Edit |   |
---|---|
Antigenic Specificity | FZD9 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-FZD9 polyclonal antibody, unconjugated |
Immunogen | FZD9 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF |
Other Names | CD349|FZD3|frizzled 9|seven transmembrane spanning receptor|frizzled homolog 9|frizzled-9|fz-9|fzE6|hFz9|frizzled class receptor 9|FZD9|Frizzled Family Receptor 9|mfz9|mFz3|Frizzled-like protein 9|frizzled class receptor 9a|fzd9a|cFz-9|fz11|fzx|hm:zehl0603|zehl0603|zg11|frizzled X|frizzled homolog 11|frizzled homolog 9b|frizzled class receptor 9b|fzd9b |
Gene, Accession # | Gene ID: 8326, 489809 |
Catalog # | ABIN630125 |
Price | $902 |
Order / More Info | FZD9 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |