Edit |   |
---|---|
Antigenic Specificity | CHST1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-CHST1 polyclonal antibody, unconjugated |
Immunogen | CHST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFVGQLFNQHLDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGASRDL |
Other Names | C6ST|GST-1|KS6ST|KSGal6ST|KSST|carbohydrate (chondroitin 6keratan) sulfotransferase 1|carbohydrate sulfotransferase 1|galactoseN-acetylglucosamineN-acetylglucosamine 6-O-sulfotransferase 1|CHST1|Carbohydrate (Keratan Sulfate Gal-6) Sulfotransferase 1|2610008E20Rik|AW125896|Gst1|N-acetylglucosamine-6-O-sulfotransferase 1|keratan sulfate Gal-6 sulfotransferase|sulfo1|sulfotransferase1|zgc:100904 |
Gene, Accession # | Gene ID: 8534, 76969, 295934, 483642 |
Catalog # | ABIN630465 |
Price | $902 |
Order / More Info | CHST1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |