Edit |   |
---|---|
Antigenic Specificity | IL11RA |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-IL11RA polyclonal antibody, unconjugated |
Immunogen | IL11 R alpha antibody was raised using the N terminal of IL11 A corresponding to a region with amino acids QLGYPPARPVVSCQAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGAD |
Other Names | CRSDA|IL-11 receptor subunit alpha|IL-11R subunit alpha|interleukin-11 receptor alpha chain|interleukin-11 receptor subunit alpha|interleukin 11 receptor subunit alpha|IL11RA|Interleukin 11 Receptor, alpha|fi26e06|il-11ra|wu:fi26e06|interleukin 11 receptor alpha chain|interleukin 11 receptor|alpha|IL-11R-alpha|interleukin 11 receptor subunit alpha 1|Il11ra1|AI314697|GP130|Il11ra2|NR1|IL-11 receptor subunit alpha-1|IL-11R subunit alpha-1|IL-11R-alpha-1|IL-11RA1|Il-11ra-alpha|NR-1|enhancer trap locus homolog 2|etl-2|alpha chain 2|interleukin-11 receptor subunit alpha-1|locus 2|novel cytokine receptor 1|interleukin 11 receptor, alpha chain 1 |
Gene, Accession # | Gene ID: 3590, 16157, 245983 |
Catalog # | ABIN635796 |
Price | $1020 |
Order / More Info | IL11RA Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |