Edit |   |
---|---|
Antigenic Specificity | CEACAM4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-CEACAM4 polyclonal antibody, unconjugated |
Immunogen | CEACAM4 antibody was raised using the N terminal of CEACAM4 corresponding to a region with amino acids FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITD |
Other Names | carcinoembryonic antigen-related cell adhesion molecule 4|LOC456061|CEACAM4|carcinoembryonic antigen related cell adhesion molecule 4|C-CAM4 protein|CEA-related cell adhesion molecule 10|CGM7|CGM7_HUMAN|NCA|Nonspecific cross-reacting antigen (NCA)|carcinoembryonic antigen CGM7|carcinoembryonic antigen gene family member 7|non-specific cross-reacting antigen W236|nonspecific cross-reacting antigen W236 |
Gene, Accession # | Gene ID: 1089 |
Catalog # | ABIN635809 |
Price | $1020 |
Order / More Info | CEACAM4 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |