Edit |   |
---|---|
Antigenic Specificity | MAGEA5 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-MAGEA5 polyclonal antibody, unconjugated |
Immunogen | MAGEA5 antibody was raised using the N terminal of MAGEA5 corresponding to a region with amino acids MSLEQKSQHCKPEEGLDTQEEALGLVGVQAATTEEQEAVSSSSPLVPGTL |
Other Names | CT1.5|MAGE5|MAGEA4|MAGE-5 antigen|MAGE-5a antigen|MAGE-5b antigen|cancer estis antigen 1.5|cancer estis antigen family 1|member 5|melanoma-associated antigen 5|MAGE family member A5|MAGEA5|Melanoma Antigen Family A, 5|Mage-a5|melanoma antigen family A|5|melanoma antigen, family A, 5 |
Gene, Accession # | Gene ID: 4104 |
Catalog # | ABIN633132 |
Price | $1020 |
Order / More Info | MAGEA5 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |