Edit |   |
---|---|
Antigenic Specificity | IGF2BP1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-IGF2BP1 polyclonal antibody, unconjugated |
Immunogen | IGF2 BP1 antibody was raised using the N terminal of IGF2 P1 corresponding to a region with amino acids PDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPT |
Other Names | CRD-BP|CRDBP|IMP-1|IMP1|VICKZ1|ZBP1|IGF-II mRNA-binding protein 1|IGF2 mRNA-binding protein 1|VICKZ family member 1|ZBP-1|coding region determinant-binding protein|insulin-like growth factor 2 mRNA-binding protein 1|zipcode-binding protein 1|insulin like growth factor 2 mRNA binding protein 1|IGF2BP1|Insulin-Like Growth Factor 2 mRNA Binding Protein 1|zip code-binding protein 1|AL024068|AW549074|D030026A21Rik|D11Moh40e|D11Moh45|Neilsen|coding region determinant binding protein|insulin-like growth factor 2|binding protein 1|zipcode binding protein 1|B-actin zipcode-binding protein 1|insulin-like growth factor 2 binding protein 1|rZBP-1|zipcode-binding protein-1|wu:fi72a06|zgc:152963 |
Gene, Accession # | Gene ID: 10642, 303477 |
Catalog # | ABIN633481 |
Price | $1020 |
Order / More Info | IGF2BP1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |