Edit |   |
---|---|
Antigenic Specificity | PCBP2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-PCBP2 polyclonal antibody, unconjugated |
Immunogen | PCBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQ |
Other Names | HNRNPE2|HNRPE2|hnRNP-E2|alpha-CP2|heterogeneous nuclear ribonucleoprotein E2|heterogenous nuclear ribonucleoprotein E2|hnRNP E2|poly(rC)-binding protein 2|poly(rC) binding protein 2|PCBP2|AW412548|Hnrpx|alphaCP-2|CBP|CTBP|heterogeneous nuclear ribonucleoprotein X|hnRNP X|putative heterogeneous nuclear ribonucleoprotein X|PCBP3|fb36h02|wu:fb36h02|zgc:55964|poly(rC) binding protein 2 L homeolog|pcbp2.L|poly(rC) binding protein 3|PolyrC-binding protein 2|heterogeneous nuclear ribonucleoprotein |
Gene, Accession # | Gene ID: 5094, 18521, 363005, 477596 |
Catalog # | ABIN629951 |
Price | $902 |
Order / More Info | PCBP2 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |