Edit |   |
---|---|
Antigenic Specificity | IGFBP7 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-IGFBP7 polyclonal antibody, unconjugated |
Immunogen | IGFBP7 antibody was raised using the C terminal of IGFBP7 corresponding to a region with amino acids RGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALH |
Other Names | AGM|FSTL2|IBP-7|IGFBP-7|IGFBP-7v|IGFBPRP1|MAC25|PSF|RAMSVPS|TAF|IGF-binding protein 7|IGFBP-rP1|PGI2-stimulating factor|angiomodulin|insulin-like growth factor-binding protein 7|prostacyclin-stimulating factor|tumor-derived adhesion factor|insulin like growth factor binding protein 7|IGFBP7|Insulin-Like Growth Factor Binding Protein 7|zgc:85888 |
Gene, Accession # | Gene ID: 3490, 289560 |
Catalog # | ABIN633886 |
Price | $1020 |
Order / More Info | IGFBP7 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |