Edit |   |
---|---|
Antigenic Specificity | CDS1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-CDS1 polyclonal antibody, unconjugated |
Immunogen | CDS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVFGFIAAYVLSKYQYFVCPVEYRSDVNSFVTECEPSELFQLQTYSLPPF |
Other Names | CDS|CDP-DAG synthase 1|CDP-DG synthase 1|CDP-DG synthetase 1|CDP-diacylglycerol synthase 1|CDP-diglyceride pyrophosphorylase 1|CDP-diglyceride synthase 1|CDP-diglyceride synthetase 1|CDS 1|CTP:phosphatidate cytidylyltransferase 1|phosphatidate cytidylyltransferase 1|CDS1|CDP-Diacylglycerol Synthase (Phosphatidate Cytidylyltransferase) 1|phosphatidate cytidylyltransferase 1-like|4833409J18Rik|AI314024|AW125888|LOW QUALITY PROTEIN: phosphatidate cytidylyltransferase 1 |
Gene, Accession # | Gene ID: 1040, 74596, 81925 |
Catalog # | ABIN634970 |
Price | $1020 |
Order / More Info | CDS1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |