Edit |   |
---|---|
Antigenic Specificity | RPS7 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-RPS7 polyclonal antibody, unconjugated |
Immunogen | RPS7 antibody was raised using the N terminal of RPS7 corresponding to a region with amino acids MFSSSAKIVKPNGEKPDEFESGISQALLELEMNSDLKAQLRELNITAAKE |
Other Names | DBA8|S7|40S ribosomal protein S7|ribosomal protein S7|RPS7|Mtu|Rps7A|S8|rpS8A|40S ribosomal protein S8|ribosomal protein S8 (rpS8A)|ribosomal protein S8|zgc:73216|30S ribosomal protein S7|CG1883|DmelCG1883|CG1883-PA|CG1883-PB|CG1883-PC|CG1883-PD|RpS7-PA|RpS7-PB|RpS7-PC|RpS7-PD|rps-7|rpS8B|ribosomal protein S8 (rpS8B)|ribosomal protein S7 S homeolog|rps7.S |
Gene, Accession # | Gene ID: 6201, 20115, 29258 |
Catalog # | ABIN633403 |
Price | $1020 |
Order / More Info | RPS7 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |