Edit |   |
---|---|
Antigenic Specificity | NCAPH |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-NCAPH polyclonal antibody, unconjugated |
Immunogen | NCAPH antibody was raised using the N terminal of NCAPH corresponding to a region with amino acids MPLPRKAPLNIPGTPVLEDFPQNDDEKERLQRRRSRVFDLQFSTDSPRLL |
Other Names | BRRN1|CAP-H|barren homolog 1|chromosome-associated protein H|condensin complex subunit 2|non-SMC condensin I complex subunit H|NCAPH|Non-SMC Condensin I Complex, Subunit H|barren|non-SMC condensin I complex|subunit H|si:dkeyp-86b9.4|zgc:158618|LOC708975|condensin complex subunit 2-like|A730011O11Rik|HCAP-H|mKIAA0074|XCAP-H homolog|barren homolog protein 1|mCAP-H|13S condensin XCAP-H subunit|barren homolog|chromosome assembly protein xCAP-H|non-SMC condensin I complex subunit H S homeolog|ncaph.S |
Gene, Accession # | Gene ID: 23397, 215387, 680089 |
Catalog # | ABIN634092 |
Price | $1020 |
Order / More Info | NCAPH Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |